PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G102000.1
Common NamePHAVU_008G102000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 561aa    MW: 62063.4 Da    PI: 8.4358
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G102000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.88.1e-1660106148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g WT++Ede l +av+ + g++Wk+Ia+ ++  R++ qc +rwqk+l
  Phvul.008G102000.1  60 KGGWTAQEDETLRNAVAVFKGKSWKKIAEFFP-DRSEVQCLHRWQKVL 106
                         688*****************************.************986 PP

2Myb_DNA-binding63.93.1e-20112158148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g+WT+eEd+++v++v+++G+  W++Ia+ ++ gR +kqc++rw+++l
  Phvul.008G102000.1 112 KGPWTQEEDDKIVELVTKYGPTKWSLIAQSLP-GRIGKQCRERWHNHL 158
                         79******************************.*************97 PP

3Myb_DNA-binding51.22.9e-16164207146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +++WT eE++ l +a++ +G++ W+ Ia+ +  gRt++ +k++w++
  Phvul.008G102000.1 164 KDAWTLEEELALMNAHRIHGNK-WAEIAKVLH-GRTDNAIKNHWNS 207
                         679*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.72855106IPR017930Myb domain
SuperFamilySSF466891.87E-1457113IPR009057Homeodomain-like
SMARTSM007171.5E-1359108IPR001005SANT/Myb domain
PfamPF002492.6E-1460106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-2162114IPR009057Homeodomain-like
CDDcd001676.19E-1263106No hitNo description
PROSITE profilePS5129432.548107162IPR017930Myb domain
SuperFamilySSF466894.77E-31109205IPR009057Homeodomain-like
SMARTSM007171.2E-17111160IPR001005SANT/Myb domain
PfamPF002491.8E-18112158IPR001005SANT/Myb domain
CDDcd001671.91E-15114158No hitNo description
Gene3DG3DSA:1.10.10.601.6E-27115161IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-22162213IPR009057Homeodomain-like
PROSITE profilePS5129421.338163213IPR017930Myb domain
SMARTSM007177.3E-15163211IPR001005SANT/Myb domain
PfamPF002492.1E-14164207IPR001005SANT/Myb domain
CDDcd001673.37E-11166209No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
MAEVVKSEEC CLENKQSTAA SCSSVSEGSG SAIHKSPGIC SPASTSPSHR RTTGPIRRAK  60
GGWTAQEDET LRNAVAVFKG KSWKKIAEFF PDRSEVQCLH RWQKVLNPEL VKGPWTQEED  120
DKIVELVTKY GPTKWSLIAQ SLPGRIGKQC RERWHNHLNP EIKKDAWTLE EELALMNAHR  180
IHGNKWAEIA KVLHGRTDNA IKNHWNSSLK KKLDFYLATG RLPPIPKNSP QVTVKDTIRR  240
SASKSILVYS NKELNAAVET SSETTAISKL DDSSRNQFES SGTVREVGDS SSVPANESAD  300
SDCVECKPGS SNIDLRCSNS EQLSKGNWGI TYGPRPDNSG FNGHSTFEHC TNNGDMSTTS  360
LIGTSLQESP TCGSLCYEPP QLHSSIPIDS LYLNYICQQN EFCSTPTLSP IGFFTPPRVK  420
GDELCTETPE SILKRAANTF PNTPSILRRR RTEVQALTSP SKVLKVDKDP RSSNETGRTN  480
DDSGSRHFSR SPASHGNVND IPSNKTFNAS PPYRLRSKRT GIVKSVEKQL EFAFDKEKND  540
DKRSNVMTED CLHEKKLVAT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-67592135159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-67592135159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007140316.10.0hypothetical protein PHAVU_008G102000g
TrEMBLV7B4200.0V7B420_PHAVU; Uncharacterized protein
STRINGGLYMA18G39740.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66163449
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09370.21e-145myb domain protein 3r-3